.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oyn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein from Methanococcus jannaschii bound to CDP. TO BE PUBLISHED
    Site NYSGXRC
    PDB Id 2oyn Target Id NYSGXRC-10141a
    Molecular Characteristics
    Source Methanococcus jannaschii
    Alias Ids TPS7977,Q60365, PF01982 Molecular Weight 15666.67 Da.
    Residues 136 Isoelectric Point 8.02
    Sequence lvklmiiegevvsglgegryflslppykeifkkilgfepyegtlnlkldrefdinkfkyietedfefng krffgvkvlpikilignkkidgaivvpkktyhsseiieiiapmklreqfnlkdgdvikilikgdkde
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.239
    Matthews' coefficent 2.18 Rfactor 0.197
    Waters 106 Solvent Content 43.46

    Ligand Information
    Ligands CDP (CYTIDINE-5'-DIPHOSPHATE) x 1
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 2oyn
    1. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     
    2. Identification and Characterization of the Enzymes Involved in Biosynthesis of FAD and Tetrahydromethanopterin in Methanocaldococcus jannaschii
    Z Mashhadi - 2010 - scholar.lib.vt.edu
     
    3. Dead_End elimination with perturbations (DEEPer): A provable protein design algorithm with continuous sidechain and backbone flexibility
    MA Hallen, DA Keedy - : Structure, Function, and , 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch