.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oz3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of L-Rhamnonate dehydratase from azotobacter vinelandii. To be Published
    Site NYSGXRC
    PDB Id 2oz3 Target Id NYSGXRC-9265m
    Related PDB Ids 3ekg 
    Molecular Characteristics
    Source Azotobacter vinelandii
    Alias Ids TPS7798,PF01188 Molecular Weight 44148.15 Da.
    Residues 394 Isoelectric Point 5.79
    Sequence msiptikqvrafvlrgggadyhdqgdghwiddhistpmgkypeyrqsrrsfginvlgtlvveieasdgn vgfavttggepaayivekhlarflegarvtdieriwdqmynstlyygrkglvintisgvdlalwdllgk vrrepvhqllggavrdelqfyatgarpdlaqkmgfiggkmplhhgpsegeeglkknleelatmrervgp dfwlmfdcwmsldlnyatrlargareyglkwieealppddywgyaelrrnaptgmmvttgeheatrwgf rmllemgccdiiqpdvgwcggvtellkisaladahnalvvphgssvysyhfvatrqnspfaeflmmapk adqvvpmfhpqllgepvpengrmrlsrldqpgfgvtlnpecqlhrpyth
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.00 Rfree 0.25702
    Matthews' coefficent 2.25 Rfactor 0.19556
    Waters 1476 Solvent Content 45.46

    Ligand Information
    Ligands GOL (GLYCEROL) x 31
    Metals NA (SODIUM) x 2

    Jmol

     
    Google Scholar output for 2oz3
    1. Evolution of Enzymatic Activities in the Enolase Superfamily: l-Rhamnonate Dehydratase
    JF Rakus, AA Fedorov, EV Fedorov, ME Glasner - Biochemistry, 2008 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch