.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oz8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative mandelate racemase from Mesorhizobium loti. To be Published
    Site NYSGXRC
    PDB Id 2oz8 Target Id NYSGXRC-9287a
    Molecular Characteristics
    Source Mesorhizobium loti
    Alias Ids TPS7808,13474288, PF01188 Molecular Weight 42453.95 Da.
    Residues 379 Isoelectric Point 6.10
    Sequence mslshfritrfqfardrvigdsqvraddvnvaalelvsesgevglgfiqtlfnplpdqqeiesvfehev wpslkgnraialvhrvnrprggnqrayslpfheavqvalwdlaakeaglplhvllgsrrnrvkayasgl dfhldddafvslfshaasigysafkikvghrdfdrdlrrlellktcvpagskvmidpneawtskealtk lvaireaghdllwvedpilrhdhdglrtlrhavtwtqinsgeyldlqgkrllleahaadilnvhgqvtd vmrigwlaaelgipisigntfleagvhmavalpevewleysfqnfdhlveqpieirdgyayapdrpghg lvlsekargewsrprrlarselgaapenprlpak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.48 Rfree 0.229
    Matthews' coefficent 3.03 Rfactor 0.174
    Waters 304 Solvent Content 59.35

    Ligand Information
    Ligands SO4 (SULFATE) x 8
    Metals

    Jmol

     
    Google Scholar output for 2oz8
    1. Crystal structure of PG16 and chimeric dissection with somatically related PG9: structure-function analysis of two quaternary-specific antibodies that effectively
    M Pancera, JS McLellan, X Wu, J Zhu - Journal of , 2010 - Am Soc Microbiol
     
    2. The LabelHash algorithm for substructure matching
    M Moll, DH Bryant, LE Kavraki - BMC bioinformatics, 2010 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch