.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ozt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of O-succinylbenzoate synthase from Thermosynechococcus elongatus BP-1. To be Published
    Site NYSGXRC
    PDB Id 2ozt Target Id NYSGXRC-9306e
    Related PDB Ids 3h7v 
    Molecular Characteristics
    Source Thermosynechococcus elongatus
    Alias Ids TPS7815,PF01188 Molecular Weight 36230.41 Da.
    Residues 322 Isoelectric Point 5.53
    Sequence mrwqwriyeeplqeplttaqgvwrsrsgiylrledeqgqvgygeiaplpgwgsetlnadialcqqlpgh ltpeimatipealpaaqfgfatawqsvgrlpyrvrpwpicallgsgqaaleqwqqswqrgqttfkwkvg vmspeeeqailkallaalppgaklrldangswdratanrwfawldrhgngkieyveqplppdqwqalls laqtvttaialdesvvsaaevqrwvdrgwpgffviktalfgdpdslslllrrglepqrlvfssalegai artaifhlletwqpchalgfgvdrwrsapllttltayerlwerldq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.42 Rfree 0.20706
    Matthews' coefficent 2.30 Rfactor 0.17755
    Waters 382 Solvent Content 46.55

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 2ozt
    1. Study of enzyme evolution within the MLE subgroup focusing on characterizing member enzymes for the purpose of discovering relationships among sequence,
    A Sakai - 2010 - gradworks.umi.com
     
    2. Dead_End elimination with perturbations (DEEPer): A provable protein design algorithm with continuous sidechain and backbone flexibility
    MA Hallen, DA Keedy - : Structure, Function, and , 2012 - Wiley Online Library
     
    3. Residues required for activity in Escherichia coli o-succinylbenzoate synthase are not conserved in all OSBS enzymes
    WW Zhu, C Wang, J Jipp, L Ferguson, SN Lucas - Biochemistry, 2012 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch