.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p0i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of L-Rhamnonate Dehydratase from Gibberella Zeae. To be Published
    Site NYSGXRC
    PDB Id 2p0i Target Id NYSGXRC-9265j
    Related PDB Ids 3fxg 
    Molecular Characteristics
    Source Gibberella zeae
    Alias Ids TPS7797,PF02746 Molecular Weight 49339.67 Da.
    Residues 447 Isoelectric Point 5.85
    Sequence mssvkdfpkikairsfiiggvgsggdyhnvkgghwlidsdistpaskweqykksrtswginvlgsflve ieatdgtvgfatgfggppacwlvhqhferfligadprntnllfeqmyrasmfygrkglpiavisvidla lwdllgkvrnepvyrliggatkerldfyctgpeptaakamgfwggkvplpfcpddgheglrknveflrk hreavgpdfpimvdcymslnvsytielvkacldlninwweeclspddtdgfalikrahptvkfttgehe ysrygfrklvegrnldiiqpdvmwlggltellkvaalaaaydvpvvphasgpysyhfqisqpntpfqey lanspdgksvlpvfgdlfidepiptkgylttadldkpgfgltinpaaraklipsdylfkvpeipqnlst gkeiksneqpdkpngtldslaakveslttstss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.10 Rfree 0.25589
    Matthews' coefficent 2.05 Rfactor 0.18999
    Waters 1025 Solvent Content 40.10

    Ligand Information
    Ligands SO4 (SULFATE) x 12;GOL (GLYCEROL) x 20
    Metals

    Jmol

     
    Google Scholar output for 2p0i
    1. Evolution of Enzymatic Activities in the Enolase Superfamily: l-Rhamnonate Dehydratase
    JF Rakus, AA Fedorov, EV Fedorov, ME Glasner - Biochemistry, 2008 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch