The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Lipoate-protein ligase A. To be Published
    Site NYSGXRC
    PDB Id 2p0l Target Id NYSGXRC-10425h
    Molecular Characteristics
    Source Streptococcus agalactiae
    Alias Ids TPS8042,BIG_791, Q3D8N4_STRAG, PF03099 Molecular Weight 31609.80 Da.
    Residues 278 Isoelectric Point 4.88
    Sequence lewqdlaqlpvsifkdyvtdaqdaekpfiwtevflreinrsnqeiilhiwpmtktvilgmldrelphle lakkeiisrgyepvvrnfgglavvadegilnfslvipdvferklsisdgylimvdfirsifsdfyqpie hfevetsycpgkfdlsingkkfaglaqrrikngiavsiylsvcgdqkgrsqmisdfykiglgdtgspia ypnvdpeimanlsdlldcpmtvedvidrmlislkqvgfndrllmirpdlvaefdrfqaksmankgmvsrde
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.04 Rfree 0.273
    Matthews' coefficent 2.10 Rfactor 0.231
    Waters 79 Solvent Content 41.42

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch