.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p1g

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative xylanase from Bacteroides fragilis. To be Published
    Site NYSGXRC
    PDB Id 2p1g Target Id NYSGXRC-10224c
    Molecular Characteristics
    Source Bacteroides fragilis
    Alias Ids TPS8003,Q64UP6, PF07313 Molecular Weight 28655.45 Da.
    Residues 258 Isoelectric Point 7.01
    Sequence mktirtlllctsllagtvaaqesslvlsnglgfvdtpykagtlevddtedliincdevdcttfveyala malcpqqgdemqegdfarnlqriryrdgkidgytsrlhyisdwinnavrqglledvtaayspfkqklsl symsthpelykslknspenvaqmakyekalsgkevhylpkdklepdglpwikngdiialttntpgldvs hmgiaiyikgqlhllhasskegkvvvgktalsqmlkdrksltgirvlrmkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.214
    Matthews' coefficent 2.18 Rfactor 0.167
    Waters 519 Solvent Content 43.67

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2p1g
    1. Structural Basis of Murein Peptide Specificity of a [gamma]-D-Glutamyl-L-Diamino Acid Endopeptidase
    Q Xu, S Sudek, D McMullan, MD Miller, B Geierstanger - Structure, 2009 - Elsevier
     
    2. Structure of the-D-glutamyl-L-diamino acid endopeptidase YkfC from Bacillus cereus in complex with L-Ala--D-Glu: insights into substrate recognition by NlpC/P60
    Q Xu, P Abdubek, T Astakhova, HL Axelrod - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch