.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p1j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a polC-type DNA polymerase III exonuclease domain from Thermotoga maritima. To be Published
    Site NYSGXRC
    PDB Id 2p1j Target Id NYSGXRC-10330d
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS8017,DPO3_THEMA, BIG_298 Molecular Weight 155354.99 Da.
    Residues 1367 Isoelectric Point 5.68
    Sequence mkkienlkwknvsfksleidpdagvvlvsvekfseeiedlvrllekktrfrvivngvqksngdlrgkil sllngnvpyikdvvfegnrlilkvlgdfardriasklrstkkqldellppgteimlevveppedllkke vpqpekreepkgeelkiedenhifgqkprkivftpskifeynkktsvkgkifkiekiegkrtvlliylt dgedslickvfndvekvegkvsvgdvivatgdlllengeptlyvkgitklpeakrmdkspvkrvelhah tkfsdqdaitdvneyvkrakewgfpaialtdhgnvqaipyfydaakeagikpifgieaylvsdvepvir nlsddstfgdatfvvldfettgldpqvdeiieigavkiqggqivdeyhtlikpsreisrksseitgitq emlenkrsieevlpeflgfledsiivahnanfdyrflrlwikkvmgldwerpyidtlalaksllklrsy sldsvveklglgpfrhhralddarvtaqvflrfvemmkkigitklsemeklkdtidytalkpfhctilv qnkkglknlyklvsdsyikyfygvprilkselienregllvgsacisgelgraalegasdseleeiakf ydyievmpldviaedeedldrerlkevyrklyriakklnkfvvmtgdvhfldpedargraallapqgnr nfenqpalylrtteemlekaieifedeeiarevvienpnriadmieevqplekklhppiienadeivrn ltmkrayeiygdplpeivqkrvekelnaiinhgyavlyliaqelvqksmsdgyvvgsrgsvgsslvanl lgitevnplpphyrcpeckyfevveddrygagydlpnkncprcgaplrkdghgipfetfmgfegdkvpd idlnfsgeyqerahrfveelfgkdhvyragtintiaersavgyvrsyeektgkklrkaemerlvsmitg vkrttgqhpgglmiipkdkevydftpiqypandrnagvftthfayetihddlvkidalghddptfikml kdltgidpmtipmddpdtlaifssvkplgvdpvelesdvgtygipefgtefvrgmlvetrpksfaelvr isglshgtdvwlnnardwinlgyaklseviscrddimnflihkgmepslafkimenvrkgkgiteemes emrrlkvpewfiesckrikylfpkahavayvsmafriayfkvhyplqfyaayftikgdqfdpvlvlrgk eaikrrlrelkampakdaqkknevsvlevalemilrgfsflppdifksdakkfliegnslripfnklpg lgdsvaesiirareekpftsvedlmkrtkvnknhielmkslgvlgdlpeteqftlf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.298
    Matthews' coefficent 2.91 Rfactor 0.229
    Waters 86 Solvent Content 57.68

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2p1j
    1. Structure of PolC reveals unique DNA binding and fidelity determinants
    RJ Evans, DR Davies, JM Bullard - Proceedings of the , 2008 - National Acad Sciences
     
    2. Functional insight into Maelstrom in the germline piRNA pathway: a unique domain homologous to the DnaQ-H 3'5'exonuclease, its lineage-specific
    D Zhang, H Xiong, J Shan, X Xia, V Trudeau - Biology direct, 2008 - biomedcentral.com
     
    3. CHARACTERIZATION OF THE N-ACETYL- -D-GLUCOSAMINYL L-MALATE SYNTHASE (BshA) AND DEACETYLASE (BshB) FUNCTIONS FOR BACILLITHIOL
    D Parsonage, GL Newton, RC Holder, BD Wallace - Biochemistry, 2010 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch