.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p27

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of protein phosphatases. J.Struct.Funct.Genom. 8 121-140 2007
    Site NYSGXRC
    PDB Id 2p27 Target Id NYSGXRC-8744a
    Related PDB Ids 2p69 2oyc 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS7921,PF00702, NP_064711 Molecular Weight 31696.26 Da.
    Residues 296 Isoelectric Point 6.12
    Sequence marcerlrgaalrdvlgraqgvlfdcdgvlwngeravpgapellerlaragkaalfvsnnsrrarpela lrfarlgfgglraeqlfssalcaarllrqrlpgppdapgavfvlggeglraelraaglrlagdpsagdg aaprvravlvgydehfsfaklreacahlrdpecllvatdrdpwhplsdgsrtpgtgslaaavetasgrq alvvgkpspymfecitenfsidpartlmvgdrletdilfghrcgmttvltltgvsrleeaqaylaagqh dlvphyyvesiadltegled
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.25
    Matthews' coefficent 2.36 Rfactor 0.211
    Waters 116 Solvent Content 47.99

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 2p27
    1. Structural genomics of protein phosphatases
    SC Almo, JB Bonanno, JM Sauder, S Emtage - Journal of structural and , 2007 - Springer
     
    2. Methods for treatment of HIV or malaria using combinations of chloroquine and protease inhibitors
    A Savarino - US Patent 7,553,844, 2009 - Google Patents
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch