.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p2e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative Fe-S biosynthesis protein from Lactobacillus salivarius with novel protein fold. To be Published
    Site NYSGXRC
    PDB Id 2p2e Target Id NYSGXRC-10399l
    Molecular Characteristics
    Source Lactobacillus salivarius
    Alias Ids TPS8033,Q1WRG6_LACS1, BIG_85 Molecular Weight 13314.38 Da.
    Residues 118 Isoelectric Point 4.81
    Sequence mkitvtddaakklqrytddsnavllldfddgvgalskvgvcslnsdfrilvvskdmdykkdynevidsn igkfyykgyskmymddnmkislntnnsllrltgdnsgelmpalsiqdfr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.48 Rfree 0.273
    Matthews' coefficent 3.21 Rfactor 0.229
    Waters 30 Solvent Content 61.67

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2p2e
    1. DsrR, a novel IscA-like protein lacking iron-and Fe-S-binding functions, involved in the regulation of sulfur oxidation in Allochromatium vinosum
    F Grimm, JR Cort, C Dahl - Journal of bacteriology, 2010 - Am Soc Microbiol
     
    2. DsrR, a novel IscA-like protein lacking iron-and 1
    F Grimm, JR Cort, C Dahl - 2010 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch