.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p2u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative host-nuclease inhibitor protein Gam from Desulfovibrio vulgaris. To be Published
    Site NYSGXRC
    PDB Id 2p2u Target Id NYSGXRC-10201b
    Molecular Characteristics
    Source Desulfovibrio vulgaris
    Alias Ids TPS7999,Q72CZ5, PF07352 Molecular Weight 19098.87 Da.
    Residues 170 Isoelectric Point 7.92
    Sequence msrrkpnpvivadirqaegalaeiatidrkvgeieaqmneaidaakarasqksapllarrkeledgvat fatlnktemfkdrksldlgfgtigfrlstqivqmskitkdmtlerlrqfgisegirikedvnkeamqgw pderlemvglkrrttdafyieinreevadtaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.75 Rfree 0.29
    Matthews' coefficent 3.62 Rfactor 0.242
    Waters 39 Solvent Content 66.05

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2p2u
    1. PackHelix: A tool for helix_sheet packing during protein structure prediction
    C Hu, P Koehl, N Max - Proteins: Structure, Function, and , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch