The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of L-Rhamnonate Dehydratase from Salmonella Typhimurium Lt2. To be Published
    Site NYSGXRC
    PDB Id 2p3z Target Id NYSGXRC-9265a
    Related PDB Ids 3d46 2gsh 3box 3d47 
    Molecular Characteristics
    Source Salmonella typhimurium
    Alias Ids TPS7792,16765618, PF01188 Molecular Weight 44703.86 Da.
    Residues 405 Isoelectric Point 5.92
    Sequence menimtlpkikhvrawfiggataekgagggdyhdqggnhwiddhiatpmskyrdyeqsrqsfginvlgt liveveaenrqtgfavstagemgcfivekhlnrfiegkcvsdiklihdqmlgatmyysgsgglvmntis cvdlalwdlfgkvvglpvykllggavrdeiqfyatgarpdlakemgfiggkmpthwgphdgdagirkda amvadmrekcgpdfwlmldcwmsqdvnyatklahacapfnlkwieeclppqqyegyrelkrnapagmmv tsgehhgtlqsfrtlaetgidimqpdvgwcgglttlveiaalaksrgqlvvphgssvyshhavitftnt pfseflmtspdcstlrpqfdpilldepvpvngrihksvldkpgfgvelnrdchlkrpysh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.25235
    Matthews' coefficent 2.35 Rfactor 0.20097
    Waters 668 Solvent Content 47.60

    Ligand Information
    Metals NA (SODIUM) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch