.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p4u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of protein phosphatases. J.Struct.Funct.Genom. 8 121-140 2007
    Site NYSGXRC
    PDB Id 2p4u Target Id NYSGXRC-8663b
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS7912,AAH39744, PF01451 Molecular Weight 17921.40 Da.
    Residues 158 Isoelectric Point 6.13
    Sequence maevgsksvlfvclgnicrspiaeavfrklvtdekvsdnwaidssavsdwnvgrppdpravsclrnhgi stahkarqitkedfatfdyilcmdesnlrdlnrksnqvknckakiellgsydpqkqliiedpyygndsd fevvyqqclrcckaflekty
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.236
    Matthews' coefficent 2.01 Rfactor 0.184
    Waters 296 Solvent Content 38.67

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 2p4u
    1. Structural genomics of protein phosphatases
    SC Almo, JB Bonanno, JM Sauder, S Emtage - Journal of structural and , 2007 - Springer
     
    2. Assessment of template based protein structure predictions in CASP9
    V Mariani, F Kiefer, T Schmidt, J Haas - Proteins: Structure, , 2011 - Wiley Online Library
     

    Protein Summary



    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch