.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p5i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein from Bacillus halodurans: Pfam-PF03099. To be Published
    Site NYSGXRC
    PDB Id 2p5i Target Id NYSGXRC-10425b
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS8041,BIG_791, Q9K6A7_BACHD, PF03099 Molecular Weight 30998.81 Da.
    Residues 278 Isoelectric Point 6.15
    Sequence mslllqqhlsqpwrfldhtsfgptfqalqsfayddtlctsigksqspptlrawvhhntvvlgiqdsrlp qikagiealkgfqhdvivrnsgglavvldsgilnlslvlkeekgfsiddgyelmyelicsmfqdhreqi eareivgsycpgsydlsidgkkfagisqrrirggvavqiylcvsgsgaerakmirtfydkavagqptkf vyprikpetmaslsellgqphnvsdvllkalmtlqqhgasllteslsadewllyeqhfarisernekllae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.21 Rfree 0.263
    Matthews' coefficent 2.69 Rfactor 0.228
    Waters 93 Solvent Content 54.30

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2p5i
    1. A novel amidotransferase required for lipoic acid cofactor assembly in Bacillus subtilis
    QH Christensen, N Martin, MC Mansilla - Molecular , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch