.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p8e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of protein phosphatases. J.Struct.Funct.Genom. 8 121-140 2007
    Site NYSGXRC
    PDB Id 2p8e Target Id NYSGXRC-8702a
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS7916,PF00481, NP_808907 Molecular Weight 42768.67 Da.
    Residues 387 Isoelectric Point 5.06
    Sequence mgafldkpktekhnahgagnglryglssmqgwrvemedahtavvgiphgledwsffavydghagsrvan ycsthllehittnedfraagksgsalelsvenvkngirtgflkideymrnfsdlrngmdrsgstavgvm ispkhiyfincgdsravlyrngqvcfstqdhkpcnprekeriqnaggsvmiqrvngslavsralgdydy kcvdgkgpteqlvspepevyeilraeedefiilacdgiwdvmsneelceyvksrlevsddlenvcnwvv dtclhkgsrdnmsivlvcfsnapkvsdeavkkdseldkhlesrveeimeksgeegmpdlahvmrilsae nipnlppggglagkrnvieavysrlnphresdggagdledpw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.82 Rfree 0.246
    Matthews' coefficent 2.09 Rfactor 0.186
    Waters 431 Solvent Content 41.20

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 2p8e
    1. A gatelatchlock mechanism for hormone signalling by abscisic acid receptors
    K Melcher, LM Ng, XE Zhou, FF Soon, Y Xu - Nature, 2009 - nature.com
     
    2. Structural genomics of protein phosphatases
    SC Almo, JB Bonanno, JM Sauder, S Emtage - Journal of structural and , 2007 - Springer
     
    3. Crystal structure of pyruvate dehydrogenase phosphatase 1 and its functional implications
    DG Vassylyev, J Symersky - Journal of molecular biology, 2007 - Elsevier
     
    4. Characterization of the active site and a unique uncompetitive inhibitor of the PPM1-type protein Phosphatase PPM1D
    Y Chuman, H Yagi, T Fukuda, T Nomura - Protein and peptide , 2008 - ingentaconnect.com
     
    5. Structural Characterization of the Multidomain Regulatory Protein Rv1364c from Mycobacterium tuberculosis
    J King-Scott, PV Konarev, S Panjikar, R Jordanova - Structure, 2011 - Elsevier
     
    6. The Bacterial Stressosome: A Modular System that Has Been Adapted to Control Secondary Messenger Signaling
    MB Quin, JM Berrisford, JA Newman, A Basl - Structure, 2012 - Elsevier
     
    7. Optimization of a cyclic peptide inhibitor of Ser/Thr phosphatase PPM1D (Wip1)
    R Hayashi, K Tanoue, SR Durell, DK Chatterjee - Biochemistry, 2011 - ACS Publications
     

    Protein Summary



    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch