.
The Open Protein Structure Annotation Network
PDB Keyword
.

2paj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Discovery and structure determination of the orphan enzyme isoxanthopterin deaminase. Biochemistry 49 4374-4382 2010
    Site NYSGXRC
    PDB Id 2paj Target Id NYSGXRC-9339a
    Molecular Characteristics
    Source Unknown
    Alias Ids TPS7822,PF01979 Molecular Weight 51748.96 Da.
    Residues 482 Isoelectric Point 5.66
    Sequence mttydtqpstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviypa wvnthhhlfqsllkgepagldatltpwlaatpyrfralfderrfrlaariglielarsgcatvadhnyv yypgmpfdssailfeeaeklglrfvllrggatqtrqleadlptalrpetldayvadierlaaryhdasp ramrrvvmapttvlysispremretaavarrlglrmhshlsetvgyqdsaysmygkspvafcgehdwlg sdvwyahlvkvdadeiallaqtgtgvahcpqsngrlgsgicpvremadagvpvsigvdgaasneaadmi sevhmtwlaqrarlgmlaqpayrggsfeggagaasiaevihwgtaggarvmgldevgkvavgyaadiav yrlddpryfglhdpaigpvasggrpsvmalfsagkrvvvddliegvdikelggearrvvrellrevvv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.286
    Matthews' coefficent 3.48 Rfactor 0.234
    Waters 85 Solvent Content 64.64

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2paj
    1. Functional Annotation and Three-Dimensional Structure of Dr0930 from Deinococcus radiodurans, a Close Relative of Phosphotriesterase in the Amidohydrolase
    DF Xiang, P Kolb, AA Fedorov, MM Meier - Biochemistry, 2009 - ACS Publications
     
    2. At the periphery of the amidohydrolase superfamily: Bh0493 from Bacillus halodurans catalyzes the isomerization of D-galacturonate to D-tagaturonate
    TT Nguyen, S Brown, AA Fedorov, EV Fedorov - Biochemistry, 2008 - ACS Publications
     
    3. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     
    4. The hunt for 8-oxoguanine deaminase
    RS Hall, AA Fedorov, R Marti-Arbona - Journal of the , 2010 - ACS Publications
     
    5. Functional Identification of Incorrectly Annotated Prolidases from the Amidohydrolase Superfamily of Enzymes
    DF Xiang, Y Patskovsky, C Xu, AJ Meyer - Biochemistry, 2009 - ACS Publications
     
    6. Functional annotation of two new carboxypeptidases from the amidohydrolase superfamily of enzymes
    DF Xiang, C Xu, D Kumaran, AC Brown, JM Sauder - Biochemistry, 2009 - ACS Publications
     
    7. Annotating enzymes of uncertain function: the deacylation of d-amino acids by members of the amidohydrolase superfamily
    JA Cummings, AA Fedorov, C Xu, S Brown - Biochemistry, 2009 - ACS Publications
     
    8. Discovery and structure determination of the orphan enzyme isoxanthopterin deaminase
    RS Hall, R Agarwal, D Hitchcock, JM Sauder - Biochemistry, 2010 - ACS Publications
     
    9. Phylogenetic analysis and molecular evolution of guanine deaminases: from guanine to dendrites
    JR Fernndez, B Byrne, BL Firestein - Journal of molecular evolution, 2009 - Springer
     
    10. The mechanism of the reaction catalyzed by uronate isomerase illustrates how an isomerase may have evolved from a hydrolase within the amidohydrolase
    TT Nguyen, AA Fedorov, LK Williams, EV Fedorov - Biochemistry, 2009 - ACS Publications
     
    11. Mechanistic studies and function discovery of mononuclear amidohydrolase enzymes
    RS Hall - 2010 - gradworks.umi.com
     
    12. Structural characterization and transcriptional regulation of the cytosolic PSD-95 interacting protein (CYPIN) and its role in neuronal dendrite branching
    JR Fernandez - 2008 - books.google.com
     
    13. ENZYMES AND METHODS FOR DEGRADING S-TRIAZINES AND DIAZINES
    C Scott, RJ Russell, CW Coppin - US Patent App. 13/ , 2009 - Google Patents
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch