The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of C-terminal domain of phosphomethylpyrimidine kinase. To be Published
    Site NYSGXRC
    PDB Id 2pb9 Target Id NYSGXRC-10417c
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS8040,Q8U193_PYRFU, BIG_769 Molecular Weight 49297.27 Da.
    Residues 451 Isoelectric Point 6.41
    Sequence mkrlvktaltiagsdsgggagieadlktftafgvhglvaitsvtaqntqavtaihdippevvaeqirav aedigvdaaktgmlsnaeiikavaktvknydfplvvdpvmiaksgapllredavdalikyilplatlvt pnrfeaeklsgmkirsvedakivakkiaeetgaeavivkgghiegeeavdvlyhngtfreyrapkvegc thgtgcsfsaaitanlakglgleeaievakkfitlgiamghrighghcpvnqsawieipaekwriyeel tnavrefesinpvrlipevgtnfvyslplpyarstkdvagvkgrivkygnsvkavgpvefgasdhlara vltymrfypeyrsainirysreiieeiieiaqergfkvsfydrreepeeikakegatipwgietaikri kerpdiiyhlgdvgkepmilvfgrnprevlekikmli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.2911
    Matthews' coefficent 2.59 Rfactor 0.2342
    Waters 53 Solvent Content 52.52

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch