.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pbe

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of an aminoglycoside 6-adenyltransferase from Bacillus subtilis. To be Published
    Site NYSGXRC
    PDB Id 2pbe Target Id NYSGXRC-10154a
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS7980,PF04439, P17585 Molecular Weight 33905.93 Da.
    Residues 284 Isoelectric Point 4.95
    Sequence mrseqemmdifldfalnderirlvtlegsrtnrnippdnfqdydisyfvtdvesfkendqwleifgkri mmqkpedmelfppelgnwfsyiilfedgnkldltlipireaedyfanndglvkvlldkdsfinykvtpn drqywikrptarefddccnefwmvstyvvkglarneilfaidhlneivrpnllrmmawhiasqkgysfs mgknykfmkrylsnkeweelmstysvngyqemwkslftcyalfrkyskavseglaykypdydegitkyt egiycsvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.65 Rfree 0.284
    Matthews' coefficent 3.00 Rfactor 0.224
    Waters 82 Solvent Content 58.99

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2pbe
    1. Obtencin y caracterizacin bioqumica de un enzima de resistencia a antibiticos aminoglicsidos: 6-Adeniltransferasa de Bacillus subtilis
    M Latorre Gutirrez - 2008 - eprints.ucm.es
     
    2. Obtencion y caracterizacin bioqumica de una enzima de resistencia a antibiticos aminoglicsidos: 6-adenil transferasa de Bacillus subtilis
    M Latorre - 2008 - handle.digital.csic.es
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch