.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pbn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of protein phosphatases. J.Struct.Funct.Genom. 8 121-140 2007
    Site NYSGXRC
    PDB Id 2pbn Target Id NYSGXRC-8615a
    Related PDB Ids 2hy3 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS7906,PF00102, NP_002832 Molecular Weight 162050.09 Da.
    Residues 1445 Isoelectric Point 6.02
    Sequence mrrllepcwwilflkitssvlhyvvcfpaltegyvgalhenrhgsavqirrrkasgdpywaysgaygpe hwvtssvscgsrhqspidildqyarvgeeyqelqldgfdnessnktwmkntgktvaillkddyfvsgag lpgrfkaekvefhwghsngsagsehsingrrfpvemqiffynpddfdsfqtaisenriigamaiffqvs prdnsaldpiihglkgvvhheketfldpfvlrdllpaslgsyyrytgslttppcseivewivfrrpvpi syhqleafysiftteqqdhvksveylrnnfrpqqrlhdrvvsksavrdswnhdmtdflenplgteaskv cssppihmkvqplnqtalqvswsqpetiyhppimnymisyswtknedekektftkdsdkdlkatishvs pdslylfrvqavcrndmrsdfsqtmlfqanttrifqgtrivktgvptaspassadmapissgsstwtss gipfsfvsmatgmgpsssgsqatvasvvtstllaglgfggggissfpstvwptrlptaasaskqaarpv lattealaspgpdgdssptkdgegteegekdeksesedgereheedgekdsekkeksgvthaaeernqt epsptpsspnrtaegghqtipgheqdhtavptdqtggrrdagpgldpdmvtstqvpptateeqyagsdp krpempskkpmsrgdrfsedsrfitvnpaekntsgmisrpapgrmewiiplivvsaltfvclilliavl vywrgcnkikskgfprrfrevpssgergekgsrkcfqtahfyvedsssprvvpnesipiipipddmeai pvkqfvkhigelysnnqhgfsedfeevqrctadmnitaehsnhpenkhknryinilaydhsrvklrplp gkdskhsdyinanyvdgynkakayiatqgplkstfedfwrmiweqntgiivmitnlvekgrrkcdqywp tenseeygniivtlkstkihacytvrrfsirntkvkkgqkgnpkgrqnervviqyhytqwpdmgvpeya lpvltfvrrssaarmpetgpvlvhcsagvgrtgtyividsmlqqikdkstvnvlgflkhirtqrnylvq teeqyifihdalleailgketevssnqlhsyvnsilipgvggktrlekqfklvtqcnakyvecfsaqke cnkeknrnssvvpserarvglaplpgmkgtdyinasyimgyyrsnefiitqhplphttkdfwrmiwdhn aqiivmlpdnqslaedefvywpsreesmnceaftvtliskdrlclsneeqiiihdfileatqddyvlev rhfqcpkwpnpdapisstfelinvikeealtrdgptivhdeygavsagmlcalttlsqqlenenavdvf qvakminlmrpgvftdieqyqfiykarlslvstkengngpmtvdkngavliadesdpaesmeslv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.234
    Matthews' coefficent 3.12 Rfactor 0.208
    Waters 238 Solvent Content 60.59

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2pbn
    1. Structural genomics of protein phosphatases
    SC Almo, JB Bonanno, JM Sauder, S Emtage - Journal of structural and , 2007 - Springer
     
    2. Small Molecule Receptor Protein Tyrosine Phosphatase (RPTP ) Ligands That Inhibit Phosphatase Activity via Perturbation of the Tryptophan-Proline-Aspartate (
    S Sheriff, BR Beno, W Zhai, WA Kostich - Journal of medicinal , 2011 - ACS Publications
     

    Protein Summary



    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch