.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pbz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an IMP biosynthesis protein PurP from Thermococcus kodakaraensis. To be Published
    Site NYSGXRC
    PDB Id 2pbz Target Id NYSGXRC-10188d
    Molecular Characteristics
    Source Pyrococcus kodakaraensis
    Alias Ids TPS7992,Q5JD28, PF06973 Molecular Weight 35137.28 Da.
    Residues 310 Isoelectric Point 5.21
    Sequence mivstiashsslqillgakkegfktrlyvspkrrpfysslpivddlvvaeemtsilnddgivvphgsfv aylgieaiekakarffgnrrflkwettfelqdkalegagiprvevvepedakpdelyfvriegprggsg hfivegseleerlstleepyrverfipgvylyvhffyspilerlellgvdervliadgnarwpvkplpy tivgnraialresllpqlydyglafvrtmreleppgvigpfalhfaydgsfkaigiasridggsnadhw yselywgerlsmgrriarelrlaeeedrleevvt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.50 Rfree 0.3
    Matthews' coefficent 2.22 Rfactor 0.276
    Waters 240 Solvent Content 44.52

    Ligand Information
    Ligands ATP (ADENOSINE-5'-TRIPHOSPHATE) x 3
    Metals

    Jmol

     
    Google Scholar output for 2pbz
    1. Crystal structure and function of 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase from Methanocaldococcus jannaschii
    Y Zhang, RH White, SE Ealick - Biochemistry, 2008 - ACS Publications
     
    2. Crystal Structure and Function of 5-Formaminoimidazole-4-carboxamide-1-_-d-ribofuranosyl 5_-Monophosphate Synthetase from Methanocaldococcus
    Y Zhang, RH White, SE Ealick - Biochemistry, 2008 - ncbi.nlm.nih.gov
     
    3. Purine biosynthesis in archaea: variations on a theme
    AM Brown, SL Hoopes, RH White, CA Sarisky - Biology Direct, 2011 - biology-direct.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch