.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pce

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative mandelate racemase/muconate lactonizing enzyme from Roseovarius nubinhibens ISM. To be Published
    Site NYSGXRC
    PDB Id 2pce Target Id NYSGXRC-9436e
    Related PDB Ids 3fv9 
    Molecular Characteristics
    Source Roseovarius nubinhibens
    Alias Ids TPS7840,ZP_00960429 Molecular Weight 39834.15 Da.
    Residues 376 Isoelectric Point 5.94
    Sequence mkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyiaahaggtraal ellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglplcdmtggrvagpvpviss iggdtpeamrakvarhraqgfkghsikigaseaeggpaldaeritacladrqpgewyladanngltveh alrmlsllppgldivleapcaswaetkslrarcalpllldeliqtetdliaairddlcdgvglkvskqg gitpmlrqraiaaaagmvmsvqdtvgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrd ggasapsdpglglrvnrdalgtpvktfgdpi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.00 Rfree 0.25
    Matthews' coefficent 2.43 Rfactor 0.202
    Waters 1001 Solvent Content 49.34

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 8
    Metals

    Jmol

     
    Google Scholar output for 2pce
    1. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch