.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pcs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of conserved protein from Geobacillus kaustophilus. To be Published
    Site NYSGXRC
    PDB Id 2pcs Target Id NYSGXRC-10024h
    Molecular Characteristics
    Source Geobacillus kaustophilus
    Alias Ids TPS7937,Q5QL47, PF06240 Molecular Weight 16399.13 Da.
    Residues 152 Isoelectric Point 5.50
    Sequence mngngsielkgtveevwsklmdpsilskcimgcksleligedkykadlqigiaavkgkydaiievtdik ppyhykllvngeggpgfvnaegvidltpindectqltytysaevggkvaaigqrmlggvakllisdffk kiqkeiakskqeas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.287
    Matthews' coefficent 2.90 Rfactor 0.239
    Waters 12 Solvent Content 57.52

    Ligand Information
    Ligands UNL (UNKNOWN) x 1
    Metals

    Jmol

     
    Google Scholar output for 2pcs
    1. High-throughput computational structure-based characterization of protein families: START domains and implications for structural genomics
    H Lee, Z Li, A Silkov, M Fischer, D Petrey - Journal of structural and , 2010 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch