.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pge

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of MenC from Desulfotalea psychrophila LSv54. To be Published
    Site NYSGXRC
    PDB Id 2pge Target Id NYSGXRC-9393a
    Molecular Characteristics
    Source Desulfotalea psychrophila
    Alias Ids TPS7836,PF01188 Molecular Weight 40563.07 Da.
    Residues 368 Isoelectric Point 5.33
    Sequence msgmelsyrrsdlifkrpagtsrgvltskptwfvrldidghggqgevslipglsldpeeqigreldlla rrlraeepirlrqflaerggadfsdyrsvltdiagildswqvstdgrfpalrfalemalldllsggrqe wfasdftrgekripvngliwmgeaafmqeqieaklaegygclklkigaidfdkecallagiresfspqq leirvdangafspanapqrlkrlsqfhlhsieqpirqhqwsemaalcansplaialdeeliglgaeqrs amldairpqyiilkpsllggfhyagqwielarergigfwitsalesnlglaaiaqwtalyqptmpqglg tgqlytnnlpsnlavdggllgvs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.238
    Matthews' coefficent 2.63 Rfactor 0.225
    Waters 245 Solvent Content 53.20

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2pge
    1. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     
    2. Study of enzyme evolution within the MLE subgroup focusing on characterizing member enzymes for the purpose of discovering relationships among sequence,
    A Sakai - 2010 - gradworks.umi.com
     
    3. Mutual information and variants for protein domain-domain contact prediction
    M Gomes, R Hamer, G Reinert - BMC Research , 2012 - biomedcentral.com
     
    4. Residues required for activity in Escherichia coli o-succinylbenzoate synthase are not conserved in all OSBS enzymes
    WW Zhu, C Wang, J Jipp, L Ferguson, SN Lucas - Biochemistry, 2012 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch