.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pgs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative deoxyguanosinetriphosphate triphosphohydrolase from Pseudomonas syringae pv. phaseolicola 1448A at 2.35 A resolution. To be Published
    Site NYSGXRC
    PDB Id 2pgs Target Id NYSGXRC-10395g
    Molecular Characteristics
    Source Pseudomonas syringae pv. phaseolicola
    Alias Ids TPS8029,BIG_823, Q48JX0_PSE14 Molecular Weight 49908.02 Da.
    Residues 446 Isoelectric Point 6.36
    Sequence vnaldwqtllnrerlgktlhspeelgrspfhkdhdriifsgafrrlgrktqvhpvssndhihtrlthsl evscvgrslgmrvgetlraalpdwcdpsdlgmvvqsaclahdignppfghsgedairnwfnqaagrgwl damseterndflnfegnaqgfrvltqleyhqfdggtrltyatlgtylkypwtarhadslgykkhkfgcy qselpileqiagklglpqleeqrwarhplvylmeaaddicyalidledglemdlldyaeveslllglvg ddlpetyrqlgpgdsrrrklailrgkaiehltnaaarafveqqdallagtlpgdlvehmhgpakrcvln akdmarkkifqdkrktlheigayttleillnafcgaaveqfggrtpsfkhrrildllgnsapdpkaplh asflrmidfiagmtdsyasemaremtgrsgqi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.35 Rfree 0.273
    Matthews' coefficent 2.41 Rfactor 0.251
    Waters 49 Solvent Content 48.96

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2pgs
    1. Characterization of the Deoxynucleotide Triphosphate Triphosphohydrolase (dNTPase) Activity of the EF1143 Protein from Enterococcus faecalis and Crystal
    II Vorontsov, G Minasov, O Kiryukhina - Journal of Biological , 2011 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch