.
The Open Protein Structure Annotation Network
PDB Keyword
.

2plm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure-based activity prediction for an enzyme of unknown function. Nature 448 775-779 2007
    Site NYSGXRC
    PDB Id 2plm Target Id NYSGXRC-455f
    Related PDB Ids 1p1m 
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS7739,NP_228744.1, PF01979 Molecular Weight 45638.93 Da.
    Residues 405 Isoelectric Point 5.16
    Sequence iignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvmpalfnththapmtllrgvaedl sfeewlfskvlpiedrltekmayygtilaqmemarhgiagfvdmyfheewiakavrdfgmralltrglv dsngddggrleenlklynewngfegrifvgfgphspylcseeylkrvfdtakslnapvtihlyetskee ydledilniglkevktiaahcvhlperyfgvlkdipffvshnpasnlklgngiapvqrmiehgmkvtlg tdgaasnnslnlffemrlasllqkaqnprnldvntclkmvtydgaqamgfksgkieegwnadlvvidld lpemfpvqniknhlvhafsgevfatmvagkwiyfdgeyptidseevkrelariekelyss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.238
    Matthews' coefficent 3.24 Rfactor 0.209
    Waters 74 Solvent Content 62.09

    Ligand Information
    Ligands SIB ((2S)-2-AMINO-4-({[(2S,3S,4R,5R)-3,4-DIHYDROXY-5-(6-) x 1
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2plm
    1. Structure-based activity prediction for an enzyme of unknown function
    JC Hermann, R Marti-Arbona, AA Fedorov, E Fedorov - Nature, 2007 - nature.com
     
    2. Case Studies: Function Predictions of Structural Genomics Results
    JD Watson, JM Thornton - From Protein Structure to Function with , 2009 - Springer
     
    3. Structure to function
    JD Watson, JM Thornton, ML Tress, G Lopez - 2008 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch