.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pmb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Predicted Nucleotide-Binding Protein from Vibrio Cholerae. To be Published
    Site NYSGXRC
    PDB Id 2pmb Target Id NYSGXRC-10386b
    Molecular Characteristics
    Source Vibrio cholerae
    Alias Ids TPS8026,BIG_805, Q9KTK3_VIBCH Molecular Weight 51028.90 Da.
    Residues 457 Isoelectric Point 5.92
    Sequence lkedtmiiqvspagsmdllsqleverlkktassdlyqlyrncslavlnsgshtdnskelldkyknfdit vmrrergiklelanppehafvdgqiikgiqehlfsvlrdivyvnmhladsqrlnltnathitnlvfgil rnagalipgatpnlvvcwgghsineveyqytrevghelglrelnictgcgpgamegpmkgaavghakqr yseyrylgltepsiiaaeppnpivnelvimpdiekrleafvrmahgiiifpggpgtaeellyilgimmh penadqpmpivltgpkqseayfrsldkfitdtlgeaarkhysiaidnpaeaarimsnamplvrqhrkdk edaysfnwslkiepefqlpfepnhesmanldlhlnqrpevlaanlrrafsgvvagnvkaegireierhg pfemhgdpvlmkkmdqllndfvaqnrmklpggsayepcykivt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.99 Rfree 0.266
    Matthews' coefficent 2.23 Rfactor 0.208
    Waters 543 Solvent Content 44.90

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 12;GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 2pmb
    1. Docking, synthesis, and NMR studies of mannosyl trisaccharide ligands for DC-SIGN lectin
    JJ Reina, I Daz, PM Nieto, NE Campillo, JA Pez - Org. Biomol. , 2008 - xlink.rsc.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch