The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a mandelate racemase/muconate lactonizing enzyme from Roseovarius sp. HTCC2601. To be Published
    Site NYSGXRC
    PDB Id 2pmq Target Id NYSGXRC-9437a
    Molecular Characteristics
    Source Roseovarius sp.
    Alias Ids TPS7841,ZP_00631584 Molecular Weight 39555.80 Da.
    Residues 367 Isoelectric Point 5.23
    Sequence mkiaeiqlfqhdlpvvngpyriasgdvwsltttivkiiaedgtigwgetcpvgptyaeahaggalaale vlasglagaealplplhtrmdsllcghnyaksaldiavhdlwgkrlgvpvhellggaltdsvssyyslg vmepdeaarqalekqregysrlqvklgarpieidieairkvweavrgtgialaadgnrgwttrdalrfs recpdipfvmeqpcnsfedleairplchhalymdedgtslntvitaaatslvdgfgmkvsrigglqhmr afrdfcaarnlphtcddawggdivsaacthiastvlprlmegawlaqpyvaehydaengvrieggrirv pqgpglgltidperfgpplfsa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.72 Rfree 0.191
    Matthews' coefficent 2.28 Rfactor 0.165
    Waters 687 Solvent Content 46.11

    Ligand Information
    Metals MG (MAGNESIUM) x 5



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch