.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pnw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of membrane-bound lytic murein transglycosylase from Agrobacterium tumefaciens. To be Published
    Site NYSGXRC
    PDB Id 2pnw Target Id NYSGXRC-10110g
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS7968,PF03562, Q8UJB9 Molecular Weight 41055.29 Da.
    Residues 370 Isoelectric Point 5.58
    Sequence mntpfsidevsfrdlpgwgqddprklfpamatilshlrnakpyrtgalgitaaelvsllelaergqvns peqarqffetnsvpfrispaqgksgfvtafyepelevsatpddvwrypiyrrppelvdidndnrpdgfd psyafgkadeegisyfpdrraidegclrgrgleiawarskvdlffvhvqgaarlvfpdgaikrityaak aghvfspigrllldrgeldpktismqtirqwladhpdevdgvlwhnrsyiffreadvagldmgpiaaak vplvagralavdrlihtfglpffihaptlthlddgkpfarlmlaldtgsaivgpargdiftgsgfeage lagtvrneadfyillpriaaeryrr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.219
    Matthews' coefficent 2.97 Rfactor 0.185
    Waters 376 Solvent Content 58.54

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2pnw
    1. Crystal structure and activity of Bacillus subtilis YoaJ (EXLX1), a bacterial expansin that promotes root colonization
    F Kerff, A Amoroso, R Herman - Proceedings of the , 2008 - National Acad Sciences
     
    2. The structure of the elicitor cerato-platanin, first member of the CP fungal protein family, reveals a double __-barrel fold and carbohydrate binding
    AL Oliveira, M Gallo, L Pazzagli, CE Benedetti - Journal of Biological , 2011 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch