.
The Open Protein Structure Annotation Network
PDB Keyword
.

2poz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative dehydratase from Mesorhizobium loti. To be Published
    Site NYSGXRC
    PDB Id 2poz Target Id NYSGXRC-9283a
    Molecular Characteristics
    Source Mesorhizobium loti
    Alias Ids TPS7807,13488170, PF01188 Molecular Weight 41712.63 Da.
    Residues 382 Isoelectric Point 5.36
    Sequence mkitgvniyllksgrlhpvlveistdegitgageagiaygvggtaaagmikdlserfligkdpsrieel wstmydhsfwaknggaiifagisaieqalwdikgkclgvpvyelfggkirdrvrayangwygaadtpde faraverplkegygalkfyplaqrvgsalqhvtrrsmsaeaielayrrvkavrdaagpeielmvdlsgg lttdetirfcrkigeldicfveepcdpfdngalkviseqiplpiavgervytrfgfrkifelqacgiiq pdigtagglmetkkicamaeaynmrvaphvcgsslietatlqleanitnfmihehypafkaddgyvevl enppsissgyfempngpglgavlikrniepylwasct
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.04 Rfree 0.237
    Matthews' coefficent 2.43 Rfactor 0.202
    Waters 743 Solvent Content 49.28

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2poz
    1. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     
    2. The LabelHash algorithm for substructure matching
    M Moll, DH Bryant, LE Kavraki - BMC bioinformatics, 2010 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch