.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ptf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein MTH_863 from Methanobacterium thermoautotrophicum bound to FMN. To be Published
    Site NYSGXRC
    PDB Id 2ptf Target Id NYSGXRC-10069i
    Molecular Characteristics
    Source Methanobacterium thermoautotrophicum
    Alias Ids TPS7947,PF04289, O26951 Molecular Weight 25154.35 Da.
    Residues 223 Isoelectric Point 5.70
    Sequence lsgalkensgkpseveythfkdlqalemergrlyetivvtwddsmvgnaapigvlctgddtvtlylyqg trtvenvlnngrftvnvtldpliftdstlgdleedmfshyrdflhlrgadafftaevvsvkklvkrdrf geselhvvkaragdvmraesfrmalnrgiyaviesliaytraefsdplvlreriaemnrvarkvggpre keamrriiqaleskis
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.35 Rfree 0.253
    Matthews' coefficent 2.35 Rfactor 0.199
    Waters 118 Solvent Content 47.56

    Ligand Information
    Ligands FMN (FLAVIN) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch