.
The Open Protein Structure Annotation Network
PDB Keyword
.

2puz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of imidazolonepropionase from Agrobacterium tumefaciens at 1.87 A resolution. Proteins 69 652-658 2007
    Site NYSGXRC
    PDB Id 2puz Target Id NYSGXRC-9252b
    Related PDB Ids 2gok 
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS7783,17937637, PF01979 Molecular Weight 44396.88 Da.
    Residues 419 Isoelectric Point 5.12
    Sequence mpgnnsakgtatgnatalwrnaqlatlnpamdgigavenaviavrngriafagpesdlpddlstadett dcggrwitpalidchthlvfggnramefemrlngatyeeiakagggivssvrdtralsdevlvaqalpr ldtllsegvstieiksgygldietelkmlrvarrletlrpvrivtsylaahatpadykgrnadyitdvv lpglekahaegladavdgfcegiafsvkeidrvfaaaqqrglpvklhaeqlsnlggaelaasynalsad hleyldetgakalakagtvavllpgafyalrekqlppvqalrdagaeialatdcnpgtspltsllltmn mgatlfrmtveecltattrnaakalgllaetgtleagksadfaiwdierpaelvyrigfnplharifkgqkvsp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.83 Rfree 0.225
    Matthews' coefficent 2.45 Rfactor 0.198
    Waters 584 Solvent Content 49.82

    Ligand Information
    Ligands NIG (N-(IMINOMETHYL)-L-GLUTAMIC) x 1
    Metals FE (FE) x 2;MG (MAGNESIUM) x 1;CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 2puz
    1. A Common Catalytic Mechanism for Proteins of the HutI Family
    R Tyagi, S Eswaramoorthy, SK Burley, FM Raushel - Biochemistry, 2008 - ACS Publications
     
    2. Functional identification and structure determination of two novel prolidases from cog1228 in the amidohydrolase superfamily
    DF Xiang, Y Patskovsky, C Xu, AA Fedorov - Biochemistry, 2010 - ACS Publications
     
    3. Structural insight into mechanism and diverse substrate selection strategy of L_ribulokinase
    R Agarwal, SK Burley - : Structure, Function, and , 2012 - Wiley Online Library
     
    4. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    5. A hierarchical order within protein structures underlies large separations between strands in __sheets
    B Wathen, Z Jia - Proteins: Structure, Function, and , 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch