.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pww

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ABC2387 from Bacillus clausii. To be Published
    Site NYSGXRC
    PDB Id 2pww Target Id NYSGXRC-10410f
    Molecular Characteristics
    Source Bacillus clausii
    Alias Ids TPS8034,BIG_5, Q5WFD8_BACSK Molecular Weight 13460.85 Da.
    Residues 117 Isoelectric Point 6.21
    Sequence vkfpdtgleekevafsivnhaakslgfihvdqwdyervmfdykivhhegtfylrvpayavkgeiprpst ivqimtpilgkyyyphgveyegetfpqavidkcnnklallaktikaew
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.82 Rfree 0.234
    Matthews' coefficent 2.19 Rfactor 0.200
    Waters 99 Solvent Content 43.82

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 2
    Metals

    Jmol

     
    Google Scholar output for 2pww
    1. Structure of LP2179, the first representative of Pfam family PF08866, suggests a new fold with a role in amino-acid metabolism
    C Bakolitsa, A Kumar, D Carlton, MD Miller - Section F: Structural , 2009 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch