.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pzz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title UPF201 archaeal specific family members reveal structural similarity to RNA-binding proteins but low likelihood for RNA-binding function. Plos One 3 e3903-e3903 2008
    Site NYSGXRC
    PDB Id 2pzz Target Id NYSGXRC-10077a
    Molecular Characteristics
    Source Methanococcus jannaschii
    Alias Ids TPS7950,PF01877, Q58959 Molecular Weight 19329.10 Da.
    Residues 170 Isoelectric Point 5.06
    Sequence meviikakvkptedkykvkkailnifpkakltfiekdnefgewegktksveklkellrsqsildaarmv lekgmtenatkfylnkqaayvgavnfdidthggifvkiladenedimkiikdiaprtkggviinedele eeeekedseeikeghkeennlkikvidnssgd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.299
    Matthews' coefficent 2.29 Rfactor 0.249
    Waters 83 Solvent Content 46.28

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2pzz
    1. UPF201 archaeal specific family members reveal structural similarity to RNA-binding proteins but low likelihood for RNA-binding function
    KN Rao, SK Burley, S Swaminathan - PloS one, 2008 - dx.plos.org
     
    2. Crystal structure of the DUF54 family protein PH1010 from hyperthermophilic archaea Pyrococcus horikoshii OT3
    K Miyazono, M Shirokane, Y Sawano - Proteins: Structure, , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch