.
The Open Protein Structure Annotation Network
PDB Keyword
.

2q01

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Glucuronate Isomerase from Caulobacter crescentus. To be Published
    Site NYSGXRC
    PDB Id 2q01 Target Id NYSGXRC-9229a
    Molecular Characteristics
    Source Caulobacter crescentus
    Alias Ids TPS7774,16125737, PF02614 Molecular Weight 55048.77 Da.
    Residues 487 Isoelectric Point 5.65
    Sequence marplsfhedrlfpsdpatrsyarglyalvkdlpiisphghtdpswfatnapfqdatdlllapdhylfr mlysqgvsldalkvrskagvpdtdpreawrvfashfylfrgtpswvwlnhvfsqvfgftefleasnadd yfdritaalatdafrpralfdrfnietlattegpheslqhhaairesgwgghvitayrpdavidfeder spraferfaetsgqdvyswksyleahrlrrqafidagatssdhghptaatadlsdveaealfnslvkgd vtpekaelfraqmltemakmslddglvmqihpgshrnhnvgllnshgrdkgadipmrteyvdalkpllt rlgndprlsiilftldettysrelaplaghypvlklgpswwfhdspegmmrfreqvtetagfyntvgfn ddtraflsiparhdvarrvdsaflarmvaehrmdlveaeelivdltynlpkkaykldqrpdwarpatlraaae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.34 Rfree 0.25125
    Matthews' coefficent 3.99 Rfactor 0.19818
    Waters 488 Solvent Content 69.17

    Ligand Information
    Ligands
    Metals K (POTASSIUM) x 3

    Jmol

     
    Google Scholar output for 2q01
    1. At the periphery of the amidohydrolase superfamily: Bh0493 from Bacillus halodurans catalyzes the isomerization of D-galacturonate to D-tagaturonate
    TT Nguyen, S Brown, AA Fedorov, EV Fedorov - Biochemistry, 2008 - ACS Publications
     
    2. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch