.
The Open Protein Structure Annotation Network
PDB Keyword
.

2q07

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of AF0587, a protein of unknown function. To be Published
    Site NYSGXRC
    PDB Id 2q07 Target Id NYSGXRC-10391c
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS8028,BIG_808, O29668_ARCFU Molecular Weight 60321.27 Da.
    Residues 528 Isoelectric Point 7.58
    Sequence mfypekrdgfsrtgkfevegrtvqtpailevgeipewdfglaptslkfiseelysrlrpineeveilts lhllsprqlvqvfedlskegvspkplyaassalpsnvslliylgadlvdnvlaiakaysgiyflgevev eisklrrlpcncihcrnrvvdevenllettakhntemlrmevekcrrlilneelrnyvegkvklnpeft aalrlsdslrnhstfprfrksrcnfsalesssrfevryfferalecykpfsdtvlllpctarkpyltsr thralrskvkvnvneiiissplvvprefellypavnydtpvtghwseeevsfvagwlkrfiekggfrkv vahvtggyrkvvervedeveaevvytaekdvlsdesierlkqeieskgkvdlyrrilehmlsyqfgitw sgkvagrypelellegkkrlarvdriygmldiyekiaayllekniytveigdfevkgtifaggvlrade kirpndvvvfhnsrifgvglaamsgkemagsekgiainvkrkfsf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.04 Rfree 0.284
    Matthews' coefficent 1.94 Rfactor 0.245
    Waters 84 Solvent Content 36.58

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2q07
    1. Discovery and Characterization of an Amidinotransferase Involved in the Modification of Archaeal tRNA
    G Phillips, VM Chikwana, A Maxwell - Journal of Biological , 2010 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch