.
The Open Protein Structure Annotation Network
PDB Keyword
.

2q08

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Glucoronate Isomerase from Bacillus halodurans. To be Published
    Site NYSGXRC
    PDB Id 2q08 Target Id NYSGXRC-9247a
    Related PDB Ids 2qee 2q6e 
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS7779,PF04909, 10173106 Molecular Weight 49942.49 Da.
    Residues 427 Isoelectric Point 5.24
    Sequence msinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwtdvsieafwam skreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyfakktseeqvdtvlqlanvs dvvmtndpfddneriswlegkqpdsrfhaalrldpllneyeqtkhrlrdwgykvndewnegsiqevkrf ltdwiermdpvymavslpptfsfpeesnrgriirdcllpvaekhnipfammigvkkrvhpalgdagdfv gkasmdgvehllreypnnkflvtmlsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmeml gtsfipqhsdarvleqliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgr ndhvtsvkveqqt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 2.00 Rfree 0.239
    Matthews' coefficent 2.94 Rfactor 0.226
    Waters 963 Solvent Content 58.18

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 16

    Jmol

     
    Google Scholar output for 2q08
    1. A molecular brake in the kinase hinge region regulates the activity of receptor tyrosine kinases
    H Chen, J Ma, W Li, AV Eliseenkova, C Xu, TA Neubert - Molecular cell, 2007 - Elsevier
     
    2. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     
    3. The mechanism of the reaction catalyzed by uronate isomerase illustrates how an isomerase may have evolved from a hydrolase within the amidohydrolase
    TT Nguyen, AA Fedorov, LK Williams, EV Fedorov - Biochemistry, 2009 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch