.
The Open Protein Structure Annotation Network
PDB Keyword
.

2q5e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of protein phosphatases. J.Struct.Funct.Genom. 8 121-140 2007
    Site NYSGXRC
    PDB Id 2q5e Target Id NYSGXRC-8717a
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS7917,PF03031, NP_005721 Molecular Weight 31759.55 Da.
    Residues 283 Isoelectric Point 5.60
    Sequence mehgsiitqarredalvltkqglvsksspkkprgrnifkalfccfraqhvgqsssstelaaykeeanti aksdllqclqyqfyqipgtcllpevteedqgricvvidldetlvhssfkpinnadfivpieiegtthqv yvlkrpyvdeflrrmgelfecvlftaslakyadpvtdlldrcgvfrarlfrescvfhqgcyvkdlsrlg rdlrktlildnspasyifhpenavpvqswfddmadtellnlipifeelsgaedvytslgaaagplacpa skrrpsq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.51 Rfree 0.278
    Matthews' coefficent 3.20 Rfactor 0.216
    Waters 91 Solvent Content 61.53

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 8

    Jmol

     
    Google Scholar output for 2q5e
    1. Structural genomics of protein phosphatases
    SC Almo, JB Bonanno, JM Sauder, S Emtage - Journal of structural and , 2007 - Springer
     
    2. Human HAD phosphatases: structure, mechanism, and roles in health and disease
    A Seifried, J Schultz, A Gohla - FEBS Journal, 2012 - Wiley Online Library
     

    Protein Summary

    The small C-terminal domain phosphatases (SCP) comprise a family of Ser/Thr-specific phosphatases that play a central role in mRNA biogenesis via regulation of RNA polymerase II (RNAP II). The largest subunit of the RNAP II complex has a C-terminal domain (CTD) linked to a region near the RNA exit pore. Reversible phosphorylation of the CTD plays a crucial role in RNAP II progression through the transcription cycle, controlling both transcriptional initiation and elongation. CTD phosphorylation status also affects RNA processing events, such as 5'-capping and 3'-processing. SCP family members also modulate the function of SMAD transcriptional regulators through dephosphorylation.
     
    SCP family phosphatases are linked to a wide range of physiological responses and pathologic processes. NYSGXRC has determined the structures of both SCP2 (PDB: 2q5e) and SCP3 (PDB: 2hhl). SCP2 interacts with the androgen receptor and appears to control promoter activity by RNAP II clearance during steroid-responsive transcriptional events. SCP3 has been identified as a tumor suppressor and is frequently deleted or its expression reduced in lung and other major human carcinomas.

    SCP2 and family members belong to the haloacid dehalogenase (HAD) superfamily, which encompasses a large number of magnesium-dependent phosphohydrolases, characterized by a conserved DXDX motif.


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch