.
The Open Protein Structure Annotation Network
PDB Keyword
.

2q6e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of glucuronate isomerase from Bacillus halodurans complexed with Zn. To be Published
    Site NYSGXRC
    PDB Id 2q6e Target Id NYSGXRC-9247a
    Related PDB Ids 2qee 2q08 
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS7780,PF04909, 10173106 Molecular Weight 49942.49 Da.
    Residues 427 Isoelectric Point 5.24
    Sequence msinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwtdvsieafwam skreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyfakktseeqvdtvlqlanvs dvvmtndpfddneriswlegkqpdsrfhaalrldpllneyeqtkhrlrdwgykvndewnegsiqevkrf ltdwiermdpvymavslpptfsfpeesnrgriirdcllpvaekhnipfammigvkkrvhpalgdagdfv gkasmdgvehllreypnnkflvtmlsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmeml gtsfipqhsdarvleqliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgr ndhvtsvkveqqt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.40 Rfree 0.246
    Matthews' coefficent 2.92 Rfactor 0.231
    Waters 196 Solvent Content 57.82

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 1;ZN (ZINC) x 3;NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 2q6e
    1. At the periphery of the amidohydrolase superfamily: Bh0493 from Bacillus halodurans catalyzes the isomerization of D-galacturonate to D-tagaturonate
    TT Nguyen, S Brown, AA Fedorov, EV Fedorov - Biochemistry, 2008 - ACS Publications
     
    2. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch