.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qah

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the 2-pyrone-4,6-dicarboxylic acid hydrolase from Sphingomonas paucimobilis. To be Published
    Site NYSGXRC
    PDB Id 2qah Target Id NYSGXRC-10053d
    Molecular Characteristics
    Source Pseudomonas paucimobilis
    Alias Ids TPS7941,O87170, PF04909 Molecular Weight 32772.69 Da.
    Residues 293 Isoelectric Point 5.18
    Sequence mtnderilswnetpskprytpppgaidahchvfgpmaqfpfspkakylprdagpdmlfalrdhlgfarn vivqaschgtdnaatldaiaraqgkargiavvdpaideaelaalheggmrgirfnflkrlvddapkdkf levagrlpagwhvviyfeadileelrpfmdaipvpividhmgrpdvrqgpdgadmkafrrlldsrediw fkatcpdrldpagppwddfarsvaplvadyadrviwgtdwphpnmqdaipddglvvdmipriaptpelq hkmlvtnpmrlywseem
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.256
    Matthews' coefficent 2.32 Rfactor 0.172
    Waters 225 Solvent Content 46.88

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qah
    1. Fast and accurate computation schemes for evaluating vibrational entropy of proteins
    B Xu, H Shen, X Zhu, G Li - Journal of computational chemistry, 2011 - Wiley Online Library
     
    2. Molecular characterization of chloranilic acid degradation in Pseudomonas putida TQ07
    LG Trevio-Quintanilla, JA Freyre-Gonzlez - The Journal of , 2011 - Springer
     
    3. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch