.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qee

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative amidohydrolase BH0493 from Bacillus halodurans C-125. To be Published
    Site NYSGXRC
    PDB Id 2qee Target Id NYSGXRC-9247a
    Related PDB Ids 2q6e 2q08 
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS7781,PF04909, 10173106 Molecular Weight 49942.49 Da.
    Residues 427 Isoelectric Point 5.24
    Sequence msinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwtdvsieafwam skreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyfakktseeqvdtvlqlanvs dvvmtndpfddneriswlegkqpdsrfhaalrldpllneyeqtkhrlrdwgykvndewnegsiqevkrf ltdwiermdpvymavslpptfsfpeesnrgriirdcllpvaekhnipfammigvkkrvhpalgdagdfv gkasmdgvehllreypnnkflvtmlsrenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmeml gtsfipqhsdarvleqliykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgr ndhvtsvkveqqt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 1.65 Rfree 0.224
    Matthews' coefficent 2.96 Rfactor 0.187
    Waters 4909 Solvent Content 58.38

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 12;CL (CHLORIDE) x 16;MG (MAGNESIUM) x 4

    Jmol

     
    Google Scholar output for 2qee
    1. Characterization of metalloproteins by high-throughput X-ray absorption spectroscopy
    W Shi, M Punta, J Bohon, JM Sauder, R D'Mello - Genome , 2011 - gb.cw.com.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch