.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qf9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of putative secreted protein DUF305 from Streptomyces coelicolor. To be Published
    Site NYSGXRC
    PDB Id 2qf9 Target Id NYSGXRC-10080f
    Molecular Characteristics
    Source Streptomyces coelicolor
    Alias Ids TPS7956,PF03713, Q8CK01 Molecular Weight 22306.21 Da.
    Residues 208 Isoelectric Point 5.56
    Sequence vtakragwiagaaaavllaaggityavagddggsripaadsadagfardmsvhhqqavemsyivrdrtd deevrrlaydiaqtqanqrgmmigwldlwalpkvssdppmtwmgmgdapsagegslmpgmatdaemkkl gtldgkqaevyylqlmtehhrggvhmakgcverctvgvekrlargmvesqeseirlmadllaergakprs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.69 Rfree 0.199
    Matthews' coefficent 1.95 Rfactor 0.163
    Waters 366 Solvent Content 36.93

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 2
    Metals

    Jmol

     
    Google Scholar output for 2qf9
    1. BIOCHEMICAL AND STRUCTURAL STUDIES OF YEAST
    VPS OLIGOMERIZATION - The mechanism of VPS4 and ESCRT , 2008 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch