.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qgo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural analysis of Fe-S cluster proteins. To be Published
    Site NYSGXRC
    PDB Id 2qgo Target Id NYSGXRC-10399g
    Molecular Characteristics
    Source Lactobacillus acidophilus
    Alias Ids TPS8032,Q5FLQ3_LACAC, BIG_85 Molecular Weight 14322.57 Da.
    Residues 131 Isoelectric Point 4.80
    Sequence mlnikftdnavdylkrreildkililitddgggkysiqggscsmgahfsiiwldkvdpdypvkianeqn vkiytsdfdktmlgpnmvmdynagslslssdeglldgsvdigngaallkanknvqmginrqc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.04 Rfree 0.267
    Matthews' coefficent 2.44 Rfactor 0.226
    Waters 29 Solvent Content 49.57

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qgo
    1. DsrR, a novel IscA-like protein lacking iron-and Fe-S-binding functions, involved in the regulation of sulfur oxidation in Allochromatium vinosum
    F Grimm, JR Cort, C Dahl - Journal of bacteriology, 2010 - Am Soc Microbiol
     
    2. DsrR, a novel IscA-like protein lacking iron-and 1
    F Grimm, JR Cort, C Dahl - 2010 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch