.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qgy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an enolase from the environmental genome shotgun sequencing of the Sargasso Sea. To be Published
    Site NYSGXRC
    PDB Id 2qgy Target Id NYSGXRC-9384a
    Molecular Characteristics
    Source Unknown
    Alias Ids TPS7834,PF01188 Molecular Weight 42864.55 Da.
    Residues 381 Isoelectric Point 5.07
    Sequence mnnqdisigklsrlkiwitdnhlsddqwsntkkfiiikittedgiegwgeafsinfrekgiaiiikelf reisnipnlsiksfynkisllsdghrgldfssatsaieialwdisgklknlplnslltkspkpnvpiya tcwsdlkkdtndylrqiekfygkkyggikiypmldslsisiqfvekvreivgdelplmldlavpedldq tksflkevssfnpywieepvdgenisllteikntfnmkvvtgekqsglvhfrelisrnaadifnpdisg mgglidiieisneasnngifisphcwnsmsvsasamlhvcssipnsekaeifpdyinfskkfcelpfdi idnkahinksaglgivihedilselsiysldeksnd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.222
    Matthews' coefficent 2.12 Rfactor 0.175
    Waters 562 Solvent Content 41.87

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 3

    Jmol

     
    Google Scholar output for 2qgy
    1. The LabelHash algorithm for substructure matching
    M Moll, DH Bryant, LE Kavraki - BMC bioinformatics, 2010 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch