.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qh0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a glyoxalase from clostridium acetobutylicum. To be Published
    Site NYSGXRC
    PDB Id 2qh0 Target Id NYSGXRC-11003p
    Related PDB Ids 3hdp 
    Molecular Characteristics
    Source Clostridium acetobutylicum
    Alias Ids TPS7860,PF00903, 3.10.180.10, Q97H22_CLOAB Molecular Weight 14576.07 Da.
    Residues 128 Isoelectric Point 6.36
    Sequence vkvhhigyavknidsalkkfkrlgyveesevvrdevrkvyiqfvinggyrvelvapdgedspinktikk gstpyhicyevediqksieemsqigytlfkkaeiapaidnrkvaflfstdigliellek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.45 Rfree 0.299
    Matthews' coefficent 2.54 Rfactor 0.235
    Waters 29 Solvent Content 51.61

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2qh0
    1. Bacterial protein structures reveal phylum dependent divergence
    MD Shortridge, T Triplet, P Revesz, MA Griep - biology and chemistry, 2011 - Elsevier
     
    2. Bacterial glyoxalase enzymes
    U Suttisansanee, JF Honek - Seminars in Cell & Developmental Biology, 2011 - Elsevier
     
    3. Structural Variation in Bacterial Glyoxalase I Enzymes
    U Suttisansanee, K Lau, S Lagishetty, KN Rao - Journal of Biological , 2011 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch