.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qh5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Mannose-6-phosphate isomerase from Helicobacter pylori. To be Published
    Site NYSGXRC
    PDB Id 2qh5 Target Id NYSGXRC-10054e
    Molecular Characteristics
    Source Helicobacter pylori
    Alias Ids TPS7942,PF01050, O24884 Molecular Weight 53368.35 Da.
    Residues 470 Isoelectric Point 6.01
    Sequence mkiknillsggsgkrlwplsrslypkqflklfdhkslfelsfkrnaslvdetlivcnekhyflaleeik neiknksvgflleslskntanaialsalmsdkedllivtpsdhlikdlqayenaikkaidlaqkgflvt fgvsidkpntefgyiespngldvkrfiekpsldkaiefqksggfyfnsgmfvfqagvfldelkkhapti lkgcerafeslenayffekkiarlseksmqdledmsidialmqqshkikmvelnakwsdlgnfnalfee aanepkenvslnqtpvfakesennlvfshkvsallgvenlavidtkdalliahkdkakdlkalvnevet nnqellqthtkvyrpwgsyevlhesgcykvkilevkpnarlslqkhfhrsehwvvisgmasveldhqlf elqanestyipkntlhrlanygkipliiievqvgeyvgeddivridddfnrqnqna
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.28900
    Matthews' coefficent 2.26 Rfactor 0.23350
    Waters 96 Solvent Content 45.50

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qh5
    1. The reaction mechanism of type I phosphomannose isomerases: New information from inhibition and polarizable molecular mechanics studies
    C Roux, J Foret, B de Courcy, N Gresh - Proteins: Structure, , 2011 - Wiley Online Library
     
    2. Functional characterization of GDP-mannose pyrophosphorylase from Leptospira interrogans serovar Copenhageni
    MD Asencin Diez, A Demonte, J Giacomelli - Archives of , 2010 - Springer
     
    3. Bacterial Type II PMIs: Exploitable Bifunctional Enzymes for Biotechnological Applications and the Rational Design of Antimicrobials
    SA Sousa, CG Ramos, J Feliciano, JH Leito - 2010 - intechopen.com
     
    4. STRUCTURAL AND FUNCTIONAL STUDIES ON THE HELICOBACTER PYLORI PROTEOME: THE STATE OF THE ART
    G Zanotti, L Cendron - Functional Proteomics & Nanotechnology- , 2010 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch