.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qjc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of protein phosphatases. J.Struct.Funct.Genom. 8 121-140 2007
    Site NYSGXRC
    PDB Id 2qjc Target Id NYSGXRC-9095b
    Molecular Characteristics
    Source Trypanosoma brucei
    Alias Ids TPS7928,PF00149, XP_847629 Molecular Weight 27094.72 Da.
    Residues 252 Isoelectric Point 9.01
    Sequence mkvqgyanvvtlpnvtgrviivgdihgcraqledllravsfkqgsdtlvavgdlvnkgpdsfgvvrllk rlgaysvlgnhdakllklvkklgkkeclkgrdaksslaplaqsiptdvetylsqlphiiripahnvmva haglhpqrpvdrqyedevttmrnliekeqeatggvtltateetndggkpwasmwrgpetvvfghdarrg lqeqykplaigldsrcvyggrlsaavfpggciisvpgwngasaaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.281
    Matthews' coefficent 2.02 Rfactor 0.247
    Waters 52 Solvent Content 39.17

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals MN (MANGANESE) x 2

    Jmol

     
    Google Scholar output for 2qjc
    1. Structural genomics of protein phosphatases
    SC Almo, JB Bonanno, JM Sauder, S Emtage - Journal of structural and , 2007 - Springer
     
    2. Evolution of the arginase fold and functional diversity
    DP Dowling, L Di Costanzo, HA Gennadios - Cellular and Molecular , 2008 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch