The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of C-terminal domain of SMU_1151c from Streptococcus mutans. To be Published
    Site NYSGXRC
    PDB Id 2qkp Target Id NYSGXRC-10381g
    Molecular Characteristics
    Source Streptococcus mutans
    Alias Ids TPS8024,Q8DU08_STRMU, BIG_803 Molecular Weight 52343.44 Da.
    Residues 455 Isoelectric Point 4.84
    Sequence mmaderievlkdillelhhgasaesvqerfnqhfkgvsaieismmehelmnadtgitfedvmglcnvha nlfkgaiadvdvpdaeqeghpvkvfkdenlalraaimrirriienytkpenedfrqeilkglkhqfdll gqfyhhytrkeklffpimeryghdsppkvmwgvdddirdlfkdakatlaklpdgsieelsqkfeafake feemifkeeaillmillesftqddwlqiasesdaygyailkptekwiphresfdneadadtsdnqlada lnqvqdanspegtntkvintpegqftitfkpkekeaaadrttqqpfgngylsveqanlilnhlpleitf vnkddifqyyndsvpaaemvfkrtpsqvgrnvelchppkvldkvkkvfellrngqrdkvnmwfqserlg kfvyvtyaavrdqagdfqgvleyvqdikpffeldsefnrdi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.75 Rfree 0.241
    Matthews' coefficent 2.13 Rfactor 0.198
    Waters 437 Solvent Content 42.39

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 2;GOL (GLYCEROL) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch