.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qr4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of oligoendopeptidase-F from Enterococcus faecium. To be Published
    Site NYSGXRC
    PDB Id 2qr4 Target Id NYSGXRC-10379l
    Molecular Characteristics
    Source Enterococcus faecium
    Alias Ids TPS8022,Q3XYC8_ENTFC, BIG_190 Molecular Weight 69699.43 Da.
    Residues 602 Isoelectric Point 4.92
    Sequence mevkqlpkreelpenltwdltkifssdqefdekylelseelkqsekhkgtldqgasqflnaiefvlrvy rqteviyvyahlkndqdtgntdyqalyarasslfskvseavswfepeilqlsddqiwqyfkeepklevy rhyiqqivdnrahvlsaeqesllagageifdassdtfavlnnadlvfptiegengeivqlshgvygqll estdrrvreaafkglysvyeqfrntfastlgthikghnfkakvrnyssareaslsnnhipesvydtlvd vvnkhlpllhrymelrkrlleveklhmydlytpvlgeapitftyeeakekalealkpmgeeymaiveka fserwidvvenkgkrsgayssgsydtnpyillnwhdtldqlftlvhemghsvhsyftrsnqpyvygdys iflaeiasttnenilteylletekdprvrayvlnhyldgfkgtvfrqtqfaefehfmhtedekgvplts eylsdsygklnakyygpaveedpeikfewsriphfyynyyvfqystgfsaasalakkilnqepealeny laylkagnsdypvevmkkagvdmtqaayiedamsmfeqrlneleelidrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.244
    Matthews' coefficent 2.78 Rfactor 0.188
    Waters 188 Solvent Content 55.69

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qr4
    1. The molecular analysis of Trypanosoma cruzi metallocarboxypeptidase 1 provides insight into fold and substrate specificity
    G Niemirowicz, D Fernndez, M Sol - Molecular , 2008 - Wiley Online Library
     
    2. ApoE mimetic peptide decreases A_ production in vitro and in vivo
    SS Minami, A Cordova, JR Cirrito - Molecular , 2010 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch