.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qsd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Protein Il1583 from Idiomarina loihiensis. To be Published
    Site NYSGXRC
    PDB Id 2qsd Target Id NYSGXRC-10217c
    Molecular Characteristics
    Source Idiomarina loihiensis
    Alias Ids TPS8001,PF07566, Q5QU98 Molecular Weight 20023.53 Da.
    Residues 177 Isoelectric Point 5.13
    Sequence mneidnklflvyvggtapganielhdirfvvgpsmeetypairkgwfgtqkglhldsfvhlhhvdgyri hltseahekpeekrlyfvnfggyfpnklaeyhdftvvvadspqsakqlaraqfskagladaeqihkddl lavddclcvdlvdnhyvtlefdgeqqplvpdwkgyqplp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.50 Rfree 0.25318
    Matthews' coefficent 3.11 Rfactor 0.21515
    Waters 279 Solvent Content 60.43

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch