.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qsj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a LuxR family DNA-binding response regulator from Silicibacter pomeroyi. To be Published
    Site NYSGXRC
    PDB Id 2qsj Target Id NYSGXRC-11021b
    Molecular Characteristics
    Source Silicibacter pomeroyi
    Alias Ids TPS7887,3.40.50.2300, Q5LQW4_SILPO, PF00072 Molecular Weight 23738.64 Da.
    Residues 220 Isoelectric Point 4.80
    Sequence mtvvlivddhhliragaknllegafsgmrvegaetvsdalafleadntvdlilldvnlpdaeaidglvr lkrfdpsnavalisgetdheliraaleagadgfipksadpqvlihavslilegeiflprsylqggrmae vatpldsserpeqnltprqrdvfelmckglankeiarlldlsestvkshvsaifkqigttsrsktiaif rqegvalpsased
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.267
    Matthews' coefficent 2.77 Rfactor 0.228
    Waters 29 Solvent Content 55.65

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch